Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica CASP-like protein BLE3(BLE3)

Recombinant Oryza sativa subsp. japonica CASP-like protein BLE3(BLE3)

SKU:CSB-CF774615OFG

Regular price £1,238.00 GBP
Regular price Sale price £1,238.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q84UT5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKVHRLMNAVLRLAAAAAAATAAVVMVTSRETTSFFGIQMEAKYSYTPSFIFFVVAYAV AAAYSLLVLAVPAGSALSRLALTTDVVLGMVLAGAVASAGAISDIAKNGNSHAGWLPVCG QIHAYCNHVMAALIAGFVALAVHFVVVMYSLHIVTDVICPCH

Protein Names:Recommended name: CASP-like protein BLE3 Alternative name(s): Protein brassinolide-enhanced 3 Short name= OsBLE3 Short name= Protein BL-enhanced 3

Gene Names:Name:BLE3 Ordered Locus Names:Os05g0245300, LOC_Os05g15630 ORF Names:OsJ_017008, OSJNBa0037H06.9

Expression Region:1-162

Sequence Info:full length protein

View full details