Gene Bio Systems
Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 4(APRL4)
Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 4(APRL4)
SKU:CSB-CF691532OFG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryza sativa subsp. japonica (Rice)
Uniprot NO.:Q5DJV7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GHGVCPRQPAAAAVLPRQSSCPAAGSPGHRAHHVGVVEGDDFVLQKAVTLVLQNREDFVA ILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEESRIKPRMLSRYGVRAFPTLFLVNST MRVRYHGSRTMNSLAMFYKDVTGMNPVSLDAISLERMEEVVNIIENDKKTEQGDSLFMFA RSPDRLLHQDTCLALASSFVLMRLLCFLLPKLNACVKQAWRMQFYELKRLLSNLS
Protein Names:Recommended name: 5'-adenylylsulfate reductase-like 4 Alternative name(s): Adenosine 5'-phosphosulfate reductase-like 4 Short name= APR-like 4 Short name= OsAPRL4
Gene Names:Name:APRL4 Ordered Locus Names:Os08g0412401, LOC_Os08g31814 ORF Names:OSJNBa0007M04.15
Expression Region:30-264
Sequence Info:full length protein
