Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 3(APRL3)

Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 3(APRL3)

SKU:CSB-CF801028OFG

Regular price £1,349.00 GBP
Regular price Sale price £1,349.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q84P95

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SPLPEACPVPTAAEEILGPGGTCTTLDRRGDPVGVIEGDEVTLAKAITLLHMNKDDYIAV LFYASWCPFSQECKPNFEILASLFPSIRHFAFEESSIRPSIISRYGIHGFPTLFLLNSTM RVRYHGPRTVKSLAAFYRDVSGFDVSMTSEAVLHSVDGIELKKDAEQENCPFWWARSPEK ILQQDTYLALATAFVILRLLYLLFPKIGSFAKRAWRRHTLFPNLVGVHEYFFTYLEQARH KFFRLYPSKRGNLQEGARNATAWASKSLASVSIGEPSTIGRTNSTNELR

Protein Names:Recommended name: 5'-adenylylsulfate reductase-like 3 Alternative name(s): Adenosine 5'-phosphosulfate reductase-like 3 Short name= APR-like 3 Short name= OsAPRL3

Gene Names:Name:APRL3 Ordered Locus Names:Os02g0754900, LOC_Os02g51850 ORF Names:OsJ_08430, P0627E03.20

Expression Region:23-311

Sequence Info:full length protein

View full details