Skip to product information
1 of 1

GeneBio Systems

Recombinant Oryza sativa subsp. japonica 13 kDa prolamin C (PROLM25)

Recombinant Oryza sativa subsp. japonica 13 kDa prolamin C (PROLM25)

SKU:P17048

Regular price £727.00 GBP
Regular price Sale price £727.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P17048

Gene Names: PROLM25

Alternative Name(s):

Abbreviation: Recombinant Oryza sativa subsp. japonica PROLM25 protein

Organism: Oryza sativa subsp. japonica (Rice)

Source: E.coli

Expression Region: 20-156aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged

Target Protein Sequence: RFDPLSQSYRQYQLQSHLLLQQQVLSPCSEFVRQQYSIVATPFWQPATFQLINNQVMQQQCCQQLRLVAQQSHYQAISIVQAIVQQLQLQQFSGVYFDQTQAQAQTLLTFNLPSICGIYPNYYSAPRSIATVGGVWY

MW: 21.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Seed storage protein; serves as a source of nitrogen, carbon and sulfur for the young developing seedling.

Reference: "Cloning and characterization of a cDNA encoding a rice 13 kDa prolamin." Masumura T., Hibino T., Kidzu K., Mitsukawa N., Tanaka K., Fujii S. Mol. Gen. Genet. 221: 1-7(1990)

Function:

View full details