Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_39078 (OsI_39078)

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_39078 (OsI_39078)

SKU:CSB-CF387290OFF

Regular price £1,268.00 GBP
Regular price Sale price £1,268.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:A2ZMM4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLEKGKKPSEQAAACRIMQVKDKLITLQPVVRACVFLATAVAAVIMGLNKQSYTTVVAI VGTRPVTQTFTAKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQRRAQSLSVHLLDMVI LTLLATGSATAASMAQLGKNGNLHARWNPICDKFGSFCNHGGIALMSSFIGVALMLALNL LSAAANSPRSNVTGQ

Protein Names:Recommended name: CASP-like protein OsI_39078

Gene Names:ORF Names:OsI_39078

Expression Region:1-195

Sequence Info:full length protein

View full details