Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oligotropha carboxidovorans UPF0060 membrane protein OCAR_5428-OCA5_c25530 (OCAR_5428, OCA5_c25530)

Recombinant Oligotropha carboxidovorans UPF0060 membrane protein OCAR_5428-OCA5_c25530 (OCAR_5428, OCA5_c25530)

SKU:CSB-CF478309OED

Regular price £1,194.00 GBP
Regular price Sale price £1,194.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5)

Uniprot NO.:B6JBL9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSLAAFVGAALMEIGGCFAFWAWLRLGQSPLWLIPGMAALALFAYLLTLVDSPLAGRAY AAYGGIYIASALVWGWAMEGHRPDRWDVAGATICLIGMAVILFGPRPAAL

Protein Names:Recommended name: UPF0060 membrane protein OCAR_5428/OCA5_c25530

Gene Names:Ordered Locus Names:OCAR_5428, OCA5_c25530

Expression Region:1-110

Sequence Info:full length protein

View full details