Gene Bio Systems
Recombinant Odontella sinensis Probable protein-export membrane protein secG(secG)
Recombinant Odontella sinensis Probable protein-export membrane protein secG(secG)
SKU:CSB-CF342625OAK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Odontella sinensis (Marine centric diatom) (Biddulphia sinensis)
Uniprot NO.:P49542
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLFLKLIWLLVSIFLISIIYLRVPRNQGLTSFATKSDLLGSPNSTEKFLNNFTLILIISY YLIAVKLNQMSIIG
Protein Names:Recommended name: Probable protein-export membrane protein secG
Gene Names:Name:secG Synonyms:ycf47
Expression Region:1-74
Sequence Info:full length protein
