Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oceanobacillus iheyensis UPF0059 membrane protein OB2993(OB2993)

Recombinant Oceanobacillus iheyensis UPF0059 membrane protein OB2993(OB2993)

SKU:CSB-CF815070OAB

Regular price £1,269.00 GBP
Regular price Sale price £1,269.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Uniprot NO.:Q8EM65

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPFTSEIISIILLAIGLSMDGFSVSLGLGMQQLRLKRIAYIGLTIGFLHMLMPLAGMLLG QVISEQIGQWTSFAGGVLLFLIGAHMFFSAFRLTEGFRWQPVGVGLWIIAFSVSLDSFTV GLGLGISGVQIFVTLFAFGIVSCFLTWLGMLIGRKVYRFLGVYSELLGGSILCGFGIFIL FS

Protein Names:Recommended name: UPF0059 membrane protein OB2993

Gene Names:Ordered Locus Names:OB2993

Expression Region:1-182

Sequence Info:full length protein

View full details