Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oceanobacillus iheyensis Thiol-disulfide oxidoreductase resA(resA)

Recombinant Oceanobacillus iheyensis Thiol-disulfide oxidoreductase resA(resA)

SKU:CSB-CF813341OAB

Regular price £1,261.00 GBP
Regular price Sale price £1,261.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)

Uniprot NO.:Q8CXF3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDIQQNKTNKQKKKRNRFIFRSSILLILVAAVVFAIVSNMKDDNKIYRVGDAAPDFQLKQ ISEEVDQSTVQLSDLEGKGVMLNFWATWCDPCKAEMPYMQDLYAEYKEKGVEIVAVSLDG TELVVDQFIDEYDLTFPVPHDKNGEVKDLYKIGPMPTTYFIKPNGEIEEIVQGALTLDRL EGYLNDIAPQQN

Protein Names:Recommended name: Thiol-disulfide oxidoreductase resA

Gene Names:Name:resA Ordered Locus Names:OB1822

Expression Region:1-192

Sequence Info:full length protein

View full details