Skip to product information
1 of 1

Gene Bio Systems

Recombinant Oat Endochitinase

Recombinant Oat Endochitinase

SKU:CSB-YP308852DPO

Regular price £874.00 GBP
Regular price Sale price £874.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P86181

Gene Names: N/A

Organism: Avena sativa (Oat)

AA Sequence: VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA

Expression Region: 1-200aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged

MW: 25.2 kDa

Alternative Name(s):

Relevance: This protein functions as a defense against chitin-containing fungal pathogens

Reference: "Oat (Avena sativa) seed extract as an antifungal food preservative through the catalytic activity of a highly abundant class I chitinase." Sorensen H.P., Madsen L.S., Petersen J., Andersen J.T., Hansen A.M., Beck H.C. Appl. Biochem. Biotechnol. 160:1573-1584(2010)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details