Recombinant Nostoc sp. Photosystem I reaction center subunit PsaK 1(psaK1)

SKU: CSB-CF349125NHR

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nostoc sp. (strain PCC 7120 / UTEX 2576)

Uniprot NO.:P58583

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AATTPLEWSPTVGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAF GHILGVGLVLGLHNLGRI

Protein Names:Recommended name: Photosystem I reaction center subunit PsaK 1 Alternative name(s): Photosystem I subunit X 1

Gene Names:Name:psaK1 Ordered Locus Names:asr4775

Expression Region:9-86

Sequence Info:full length protein