Gene Bio Systems
Recombinant Nostoc sp. NAD(P)H-quinone oxidoreductase subunit L(ndhL)
Recombinant Nostoc sp. NAD(P)H-quinone oxidoreductase subunit L(ndhL)
SKU:CSB-CF852324NHR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nostoc sp. (strain PCC 7120 / UTEX 2576)
Uniprot NO.:Q8YMW5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIVPLLYLALAGAYLLVVPVALLFYLKLRWYVVSSIERTFMYFLVFLFFPGLLVLSPFVN LRPRPRKIEV
Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L
Gene Names:Name:ndhL Ordered Locus Names:asr4809
Expression Region:1-70
Sequence Info:full length protein
