Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nomascus leucogenys UPF0767 protein C1orf212 homolog

Recombinant Nomascus leucogenys UPF0767 protein C1orf212 homolog

SKU:CSB-CF517262NHM

Regular price £1,178.00 GBP
Regular price Sale price £1,178.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)

Uniprot NO.:G1S9B8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDE LLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN

Protein Names:Recommended name: UPF0767 protein C1orf212 homolog

Gene Names:

Expression Region:1-92

Sequence Info:full length protein

View full details