Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nitrosococcus oceani Probable intracellular septation protein A(Noc_2385)

Recombinant Nitrosococcus oceani Probable intracellular septation protein A(Noc_2385)

SKU:CSB-CF668360NAAI

Regular price £1,270.00 GBP
Regular price Sale price £1,270.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848)

Uniprot NO.:Q3J8K3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLFFDLFPIILFFAAYQLYDQLPPDIVAGLDRIPFLVLIPGAPENAILFATAIAILASV LQVGLYFFKHHRFESMHLVTLGLVVVLGGATLMFRDPTFIKWKPTVVNWLFGLAFLASQL FTRKPLVQRMMSTAITLPTSIWNRLNGAWIIFFLVSGLANLYVAYAFTEAVWVNFKLFGM LGLTLLFVVGQAFYLTRYLNPSED

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Noc_2385

Expression Region:1-204

Sequence Info:full length protein

View full details