Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-5, mitochondrial

Recombinant Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-5, mitochondrial

SKU:CSB-CF344319NHE

Regular price £1,278.00 GBP
Regular price Sale price £1,278.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nicotiana tabacum (Common tobacco)

Uniprot NO.:P51135

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSNSVSPAHQTGLVSDLPATVAAIKNPSSKIVYDDSNHERYPPGDPSKRAFAYFVLTGGR FVYASLVRLLILKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTDE DINLANSVDLGSLRDPQQDAERVKNPEWLVVIGVCTHLGCIPLPNAGDFGGWFCPCHGSH YDISGRIRKGPAPYNLEVPTYSFMEENKLLIG

Protein Names:Recommended name: Cytochrome b-c1 complex subunit Rieske-5, mitochondrial EC= 1.10.2.2 Alternative name(s): Complex III subunit 5-5 Rieske iron-sulfur protein 5 Short name= RISP5 Ubiquinol-cytochrome c reductase iron-sulfur s

Gene Names:

Expression Region:57-268

Sequence Info:full length protein

View full details