Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neurospora crassa Protein sym-1(sym-1)

Recombinant Neurospora crassa Protein sym-1(sym-1)

SKU:CSB-CF745797NHA

Regular price £1,242.00 GBP
Regular price Sale price £1,242.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:Q7SCY7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSWYKAQLAARPLLTQAVTTSILFGVGDVAAQQLVDRRGLSNHDLTRTGRMVLYGGAVF GPAATTWFRFLQKRVVVPGSTNKTILARVAADQGLFAPTFIGIFLGSMAVLEGTDVKEKL QKNYWEALSTNWMVWPFVQMVNFKVVPLDHRVLFVNVISIGWNCYLSWLNGQ

Protein Names:Recommended name: Protein sym-1

Gene Names:Name:sym-1 ORF Names:NCU02117

Expression Region:1-172

Sequence Info:full length protein

View full details