Gene Bio Systems
Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-22(tim-22)
Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-22(tim-22)
SKU:CSB-CF883669NHA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Uniprot NO.:Q9C1E8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNFPGMPGGAAPSGGAAPGGYDPNDPNIKMMQKAMESCFAKTVMSGGAGFALGGVFGMFM ASMAYDTPYHSPTTPGTGPGANPAAAGIPGYKPVDLSSMPLKEQLKHGFKDMGQRSYSTA KNFAKVGALFSGIECGIEGLRAKNDLGNGVAAGCLTGAILAKNGGPQAAAVGCAGFAAFS AAIDAWMRMPSEED
Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit tim-22
Gene Names:Name:tim-22 ORF Names:99H12.010, NCU03798
Expression Region:1-194
Sequence Info:full length protein
