Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neurospora crassa ATP synthase subunit 9, mitochondrial(oli)

Recombinant Neurospora crassa ATP synthase subunit 9, mitochondrial(oli)

SKU:CSB-CF360585NHA

Regular price £1,062.00 GBP
Regular price Sale price £1,062.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:P00842

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YSSEIAQAMVEVSKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILG FAFVEAIGLFDLMVALMAKFT

Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein

Gene Names:Name:oli Synonyms:atp-9, atp9, prl-1 ORF Names:B13D24.340, NCU02250

Expression Region:67-147

Sequence Info:full length protein

View full details