Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neosartorya fumigata Protein get1(get1)

Recombinant Neosartorya fumigata Protein get1(get1)

SKU:CSB-CF537766NGT

Regular price £1,281.00 GBP
Regular price Sale price £1,281.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)

Uniprot NO.:B0Y5H9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTSRNARQQSRLKREVVQLKR EMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDWSVKIARWLSTNGLKIF LQFYYSKTPVFALPAGWFPFYVEWVLSFPRAPRGSVSVQVWNSVCATAIAVMAEIVTSML LQLRSRSASPASTAKAQKAQ

Protein Names:Recommended name: Protein get1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:get1 ORF Names:AFUB_063460

Expression Region:1-200

Sequence Info:full length protein

View full details