Skip to product information
1 of 1

Gene Bio Systems

Recombinant Nematostella vectensis UPF0443 protein v1g164247 (v1g164247)

Recombinant Nematostella vectensis UPF0443 protein v1g164247 (v1g164247)

SKU:CSB-CF415233NGO

Regular price £1,152.00 GBP
Regular price Sale price £1,152.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Nematostella vectensis (Starlet sea anemone)

Uniprot NO.:A7RYM7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRQLPGKAAKETRKMKRERKQQNKEGHNRVVTVAIPVCLAVFVMLIVYVYSATSKHRKWA RR

Protein Names:Recommended name: UPF0443 protein v1g164247

Gene Names:ORF Names:v1g164247

Expression Region:1-62

Sequence Info:full length protein

View full details