Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria meningitidis serogroup B Na(+)-translocating NADH-quinone reductase subunit C(nqrC)

Recombinant Neisseria meningitidis serogroup B Na(+)-translocating NADH-quinone reductase subunit C(nqrC)

SKU:CSB-CF888443NGG

Regular price £1,346.00 GBP
Regular price Sale price £1,346.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neisseria meningitidis serogroup B (strain MC58)

Uniprot NO.:Q9K0M5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKKFDKDSFSGTLIVVLAVSLICSVIVAGAVVGLKPIQEKQKLQDKQGYILSVAGLMDK DTDIGKTFAERIEQRVVDLATGEYVADAPKDFSARIAGKDPAQSIRIKTEDDLAGIKSRA KYTEVYLVKGEDGKIGQIILPMHGNGLWSVMYGFVAIQPDGNTINGITYYEQGETPGLGG EIGNPLWQQKFVGKKLFDGQGKLALHVGKGAGSDKEHGVDALSGASLTSKGVQGSFAYWF GENGYIPYLNKLKSAGAQ

Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit C Short name= Na(+)-NQR subunit C Short name= Na(+)-translocating NQR subunit C EC= 1.6.5.- Alternative name(s): NQR complex subunit C NQR-1 subunit C

Gene Names:Name:nqrC Ordered Locus Names:NMB0567

Expression Region:1-258

Sequence Info:full length protein

View full details