Skip to product information
1 of 1

Gene Bio Systems

Recombinant Natronomonas pharaonis Sensory rhodopsin-2(sop2)

Recombinant Natronomonas pharaonis Sensory rhodopsin-2(sop2)

SKU:CSB-CF337001NAX

Regular price £1,306.00 GBP
Regular price Sale price £1,306.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Natronomonas pharaonis (Natronobacterium pharaonis)

Uniprot NO.:P42196

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGW VPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPG IERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLL GPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAEHGESLAGVDTDAPAVAD

Protein Names:Recommended name: Sensory rhodopsin-2 Alternative name(s): Sensory rhodopsin II Short name= SR-II

Gene Names:Name:sop2 Synonyms:sopII

Expression Region:1-239

Sequence Info:full length protein

View full details