Skip to product information
1 of 1

Gene Bio Systems

Recombinant NAD(P)H-quinone oxidoreductase subunit L, organellar chromatophore

Recombinant NAD(P)H-quinone oxidoreductase subunit L, organellar chromatophore

SKU:CSB-CF540972ESL

Regular price £1,066.00 GBP
Regular price Sale price £1,066.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Paulinella chromatophora

Uniprot NO.:B1X3F0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFFRYLSDISSETRTLLLAYGVLGGLYLILVPLALYWWMNRRWYIMGKIERLFVYGLVF LFFPGLILLSPFLNMRLKGQGET

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L, organellar chromatophore EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L

Gene Names:Name:ndhL Ordered Locus Names:PCC_0007

Expression Region:1-83

Sequence Info:full length protein

View full details