Skip to product information
1 of 1

Gene Bio Systems

Recombinant Myxoma virus E3 ubiquitin-protein ligase LAP(LAP)

Recombinant Myxoma virus E3 ubiquitin-protein ligase LAP(LAP)

SKU:CSB-CF857874MMS

Regular price £1,272.00 GBP
Regular price Sale price £1,272.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Myxoma virus (strain Lausanne) (MYXV)

Uniprot NO.:Q997C2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATVVNMDTVVNLDDVSLADKCCWICKEACDIVPNYCKCRGDNKIVHKECLEEWINTDVV KNKSCAICESPYNLKRRYKKITKWRCYKRDCHDSLLVNMSLCLIVGGMGGYLLISTEIVK LIASEEVSNIAKVFLVSASMGPFMVSALTMVRACIDCRTYFIATRERNTIHEVAEMEDVE EVEEVNDDDGDEYVDAVEEIVVESPA

Protein Names:Recommended name: E3 ubiquitin-protein ligase LAP EC= 6.3.2.- Alternative name(s): Leukemia associated protein Short name= LAP

Gene Names:Name:LAP Ordered Locus Names:m153R

Expression Region:1-206

Sequence Info:full length protein

View full details