Gene Bio Systems
Recombinant Myxococcus xanthus UPF0060 membrane protein MXAN_4406(MXAN_4406)
Recombinant Myxococcus xanthus UPF0060 membrane protein MXAN_4406(MXAN_4406)
SKU:CSB-CF627720MXB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Myxococcus xanthus (strain DK 1622)
Uniprot NO.:Q1D445
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLLYAFGLFVLTAVAEVVGCYLPYLWLRQGKSPLLLVPAAGSLAVFAWLLTLHPTGAAR TYAAYGGVYIAVALVWLWLVEGERPTTWDLVGALVAILGMAIIVLGPRR
Protein Names:Recommended name: UPF0060 membrane protein MXAN_4406
Gene Names:Ordered Locus Names:MXAN_4406
Expression Region:1-109
Sequence Info:full length protein
