Skip to product information
1 of 1

Gene Bio Systems

Recombinant Myeloproliferative leukemia virus Myeloproliferative leukemia protein(V-MPL)

Recombinant Myeloproliferative leukemia virus Myeloproliferative leukemia protein(V-MPL)

SKU:CSB-CF331243MMB

Regular price £1,254.00 GBP
Regular price Sale price £1,254.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Myeloproliferative leukemia virus (MpLV)

Uniprot NO.:P40931

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LELRPRARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSETAWITLVTALLLVLSLSALL GLLLLKWQFPAHYRRLRHALWPSLPDLHRVLGQYLRDTAALSPSKATVTDSCEEVEPSLL EILPKSSESTPLPLCPSQPQMDYRGLQPCLRTMPLSVCPPMAETGSCCTTHIANHSYLPL SYWQ

Protein Names:Recommended name: Myeloproliferative leukemia protein

Gene Names:Name:V-MPL

Expression Region:1-184

Sequence Info:full length protein

View full details