Recombinant Mycoplasma synoviae  ATP synthase subunit c(atpE)

Recombinant Mycoplasma synoviae ATP synthase subunit c(atpE)

CSB-CF674446MAAV
Regular price
£857.00 GBP
Sale price
£857.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma synoviae (strain 53)

Uniprot NO.:Q4A5Z9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQLQNLAEALSASSPVSGTVQTVVDGNTTTTTTTNTGLGVVAVGAGLAMIGAIGSGLGQ GYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVALLLIFVGK

Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpE Ordered Locus Names:MS53_0410

Expression Region:1-111

Sequence Info:full length protein

Your list is ready to share