Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_112 (MPN_112)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_112 (MPN_112)

SKU:CSB-CF300482MLW

Regular price £1,210.00 GBP
Regular price Sale price £1,210.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75450

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLDKLLQKFRDQKKPVFHKEEGYWEISALRKWAAILIIAFGAGIIYIVPYFAFFQFKTAV ANVTGVEPNRISLLLTAYGIVSLLFYIPGGWLADRISAKALFSVSMFGTGIITFWYFLVG LKGIVWITPN

Protein Names:Recommended name: Uncharacterized protein MPN_112

Gene Names:Ordered Locus Names:MPN_112 ORF Names:C09_orf130b, MP042

Expression Region:1-130

Sequence Info:full length protein

View full details