Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG350.1 homolog (MPN_527)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG350.1 homolog (MPN_527)

SKU:CSB-CF303398MLW

Regular price £1,311.00 GBP
Regular price Sale price £1,311.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75251

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNGARIAFWPKKEQHQLFNLSFSAMMLALALIASFVSHFISIPFLSALKLTIDISSVFLI ACAFFVSYSWALVITVALSLCSFIWDGNNWIGILTLTIANFAIVSFTRLYFHIFAQIKLR WLWVFSLATLSNTLLLTTLNGLLITPLYWYWFGYVPTANFVEVAKIYNKTPYFHFFLFGV PNYWGGIFALYSLFNVIKFTLVSLIGVPVMRAFQKFYWKKAQIVY

Protein Names:Recommended name: Uncharacterized protein MG350.1 homolog

Gene Names:Ordered Locus Names:MPN_527 ORF Names:G12_orf225, MP315

Expression Region:1-225

Sequence Info:full length protein

View full details