Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma pneumoniae Putative Xaa-Pro aminopeptidase(pepP)

Recombinant Mycoplasma pneumoniae Putative Xaa-Pro aminopeptidase(pepP)

SKU:CSB-EP303407MLW

Regular price £877.00 GBP
Regular price Sale price £877.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P75313

Gene Names: pepP

Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)

AA Sequence: MHNELQQKLAVLHKLLQDNKADAILIGSDQNRFWLTGFPSSAGWLVVHKQRVNLFIDGRYFEAAKTAIDPLVKVELFTTYKQVKALCEQVGVKHLLIEGDYLTFNYQNFIKELCAQYTVINAQEIRRQKLPSEILAIEKVVEITRKVAVKLKRFIQPGMTELFIAQWITDQLVKAGGAKNSFDPIVATGKNGANPHHKPSKLKVKSGDFVTCDFGTIYNGYCSDITRTFLVGKKPNNEVLLKAYKKVDEANMAGINAANTQLTGAEVDKVCRDIIEASEFKDYFVHSTGHGVGLDIHEMPNVSTSYNKLLCENAVITIEPGIYIPSVGGIRIEDMVLVKDHKSVWLSAKIPRAF

Expression Region: 1-354aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 55.6 kDa

Alternative Name(s): Short name: X-Pro aminopeptidase Alternative name(s): Aminoacylproline aminopeptidase Aminopeptidase P Short name: APP

Relevance:

Reference: "Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996) .

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details