Skip to product information
1 of 1

GeneBio Systems

Recombinant Mycoplasma pneumoniae P30 adhesin (p30), partial

Recombinant Mycoplasma pneumoniae P30 adhesin (p30), partial

SKU:P75330

Regular price £833.00 GBP
Regular price Sale price £833.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Epigenetics and Nuclear Signaling

Uniprot ID: P75330

Gene Names: p30

Alternative Name(s): 30 kDa adhesin-related protein (Cytadhesin P30)

Abbreviation: Recombinant Mycoplasma pneumoniae P30 adhesin protein, partial

Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Source: Yeast

Expression Region: 106-274aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: RLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR

MW: 19.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Adhesin necessary for successful cytadherence and virulence.

Reference: "Characterization of the gene for a 30-kilodalton adhesion-related protein of Mycoplasma pneumoniae." Dallo S.F., Chavoya A., Baseman J.B. Infect. Immun. 58: 4163-4165(1990)

Function:

View full details