Recombinant Mycoplasma pneumoniae Lon protease(lon),partial

SKU: CSB-EP305230MLW

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: P78025

Gene Names: lon

Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)

AA Sequence: MPAVKKPQILVVRNQVIFPYNGFELDVGRERSKKLIKALKNLKTKRLVLVTQKNSDQLNPEFDDIYHCGTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITSFSDADLTKYDHHFLNSTLTENKALDKLLERIFPDKEDFAEILDSLNSFLELQELKKLSKVPKDIKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKII

Expression Region: 1-206aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 39.8 kDa

Alternative Name(s): ATP-dependent protease La

Relevance: ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner.

Reference: "Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.