Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma genitalium Lipoprotein signal peptidase(lspA)

Recombinant Mycoplasma genitalium Lipoprotein signal peptidase(lspA)

SKU:CSB-CF672067MLN

Regular price £1,256.00 GBP
Regular price Sale price £1,256.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Uniprot NO.:Q49401

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLRKTKFFSQLKHQVLTANQKPFLFYKLTMIGFVGFIILLQVFILRNALNGEMDNTMVA NSGFINIYVIRNKGVGFSLLQNQTGLVYFLQGLLSVIALVFLVFMVKYSYIFWITTLAFG SLGNFFDRLTSANDSVLDYFIFQNGSSVFNFADCCITFGFIGLFFCFLIQMFKEFKHSKN Q

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Synonyms:lsp Ordered Locus Names:MG210

Expression Region:1-181

Sequence Info:full length protein

View full details