Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium ulcerans UPF0233 membrane protein MUL_0015 (MUL_0015)

Recombinant Mycobacterium ulcerans UPF0233 membrane protein MUL_0015 (MUL_0015)

SKU:CSB-CF367575MOP

Regular price £1,179.00 GBP
Regular price Sale price £1,179.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium ulcerans (strain Agy99)

Uniprot NO.:A0PKC4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKSKVRKKNDFTVKPVSRTPVKVKVGPSSVWFVALFIGLMLIGLVWLMVFQLAAVGSQA PAALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

Protein Names:Recommended name: UPF0233 membrane protein MUL_0015

Gene Names:Ordered Locus Names:MUL_0015

Expression Region:1-93

Sequence Info:full length protein

View full details