Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium tuberculosis UPF0060 membrane protein TBFG_12657 (TBFG_12657)

Recombinant Mycobacterium tuberculosis UPF0060 membrane protein TBFG_12657 (TBFG_12657)

SKU:CSB-CF375947MOO

Regular price £1,194.00 GBP
Regular price Sale price £1,194.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis (strain F11)

Uniprot NO.:A1QUS1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGR VLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH

Protein Names:Recommended name: UPF0060 membrane protein TBFG_12657

Gene Names:Ordered Locus Names:TBFG_12657

Expression Region:1-110

Sequence Info:full length protein

View full details