Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)

Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)

SKU:CSB-BP358713MVZb0

Regular price £528.00 GBP
Regular price Sale price £528.00 GBP
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: mpt64

Biologically active: Not Tested

Expression system: Baculovirus

Species of origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Delivery time: 3-7 business days

Uniprot ID: P9WIN8

AA Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA

Tag info: N-terminal 10xHis-tagged

Expression Region: 24-228aa

Protein length: Full Length of Mature Protein

MW: 24.5 kDa

Alternative Name(s): Antigen MPT64

Relevance:

Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains." Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M. J. Bacteriol. 184:5479-5490(2002)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details