Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85A(fbpA)

Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85A(fbpA)

SKU:CSB-EP358584MVZ

Regular price £699.00 GBP
Regular price Sale price £699.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Microbiology

Uniprot ID:P9WQP2

Gene Names:fbpA

Organism:Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

AA Sequence:FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA

Expression Region:44-338aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 6xHis-SUMO-tagged

MW:44.6 kDa

Alternative Name(s):DGAT(Acyl-CoA:diacylglycerol acyltransferase) (Antigen 85 complex A) (85A) (Ag85A) (Fibronectin-binding protein A) (Fbps A) (mpt44)

Relevance:The antigen 85 proteins are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages. They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate. They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerolas the acyl acceptor.

Reference:"Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains." Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M. J. Bacteriol. 184:5479-5490(2002)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details