Gene Bio Systems
Recombinant Mycobacterium tuberculosis Antitoxin MT2731(MT2731)
Recombinant Mycobacterium tuberculosis Antitoxin MT2731(MT2731)
SKU:CSB-YP300323MVZ
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P9WJ10
Gene Names: MT2731
Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
AA Sequence: MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP
Expression Region: 1-81aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 9.7 kDa
Alternative Name(s):
Relevance: Antitoxin component of a toxin-antitoxin (TA) module. Neutralizes the effect of cognate toxin MT2730
Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
