Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium smegmatis UPF0060 membrane protein MSMEG_3252 (MSMEG_3252)

Recombinant Mycobacterium smegmatis UPF0060 membrane protein MSMEG_3252 (MSMEG_3252)

SKU:CSB-CF371086MVX

Regular price £1,188.00 GBP
Regular price Sale price £1,188.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

Uniprot NO.:A0QXC5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVGKSVVLFVLAAVLEIGGAWLVWQGLREQRGWLWAGAGVIALGAYGFVAAFQPDANFGR VLAAYGGVFIAGSLLWGMIADGFRPDRWDVAGAAVALVGVGLIMYAPR

Protein Names:Recommended name: UPF0060 membrane protein MSMEG_3252

Gene Names:Ordered Locus Names:MSMEG_3252

Expression Region:1-108

Sequence Info:full length protein

View full details