Gene Bio Systems
Recombinant Murine adenovirus A serotype 1 Early E3 17.7 kDa glycoprotein
Recombinant Murine adenovirus A serotype 1 Early E3 17.7 kDa glycoprotein
SKU:CSB-CF321718MUS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Murine adenovirus A serotype 1 (MAdV-1) (Murine adenovirus 1)
Uniprot NO.:P19720
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGKLTVCTSKPYLNFSRAIRTYLCGSKCDNAIYFTPQKIVIELVQEKKTTQLLLLLAASI ALYLLSPQLGARMLFELVQARTTSVSNSSVAAALFACAGEEIINPAIFLFLHVLTLVIVL AMAAEVIYNRCRRTTRPTAPPPPVNNADFNLADALDETYNK
Protein Names:Recommended name: Early E3 17.7 kDa glycoprotein
Gene Names:
Expression Region:1-161
Sequence Info:full length protein
