Gene Bio Systems
Recombinant Mouse Versican core protein(Vcan),partial
Recombinant Mouse Versican core protein(Vcan),partial
SKU:CSB-EP720284MO
Couldn't load pickup availability
Size:20ug. Other sizes are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:Q62059
Gene Names:Vcan
Organism:Mus musculus (Mouse)
AA Sequence:AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA
Expression Region:24-146aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:20.9 kDa
Alternative Name(s):Chondroitin sulfate proteoglycan core protein 2 (Chondroitin sulfate proteoglycan 2) (Large fibroblast proteoglycan) (PG-M) (Cspg2)
Relevance:May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Reference:"Selective activation of the versican promoter by epithelial- mesenchymal interactions during hair follicle development." Kishimoto J., Ehama R., Wu L., Jiang S., Jiang N., Burgeson R.E. Proc. Natl. Acad. Sci. U.S.A. 96:7336-7341(1999)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Involvement in disease:
Subcellular Location:Secreted, extracellular space, extracellular matrix
Protein Families:Aggrecan/versican proteoglycan family
Tissue Specificity:Isoform V2 is found only in brain.
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=158700
KEGG Database Link:
STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000105173
OMIM Database Link:
Lead Time Guidance:3-7 business days
