Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Uroplakin-2(Upk2)

Recombinant Mouse Uroplakin-2(Upk2)

SKU:CSB-CF025656MO

Regular price £1,204.00 GBP
Regular price Sale price £1,204.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P38575

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK

Protein Names:Recommended name: Uroplakin-2 Short name= UP2Alternative name(s): Uroplakin II Short name= UPII

Gene Names:Name:Upk2

Expression Region:85-184

Sequence Info:full length protein

View full details