Gene Bio Systems
Recombinant Mouse Uncharacterized protein C10orf35 homolog
Recombinant Mouse Uncharacterized protein C10orf35 homolog
SKU:CSB-CF866708MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9D882
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVRILANGEIVQDDDPRVRTTTQHRSSSSQQGFFNRGHGAPPGGPGPRQQQAGARLGAAQ SPFSDLNRQLVNMGFPQWHLGNHVVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR
Protein Names:Recommended name: Uncharacterized protein C10orf35 homolog
Gene Names:
Expression Region:1-120
Sequence Info:full length protein
