Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Transthyretin(Ttr)

Recombinant Mouse Transthyretin(Ttr)

SKU:CSB-EP025270MO

Regular price £679.00 GBP
Regular price Sale price £679.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P07309

Gene Names: Ttr

Organism: Mus musculus (Mouse)

AA Sequence: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Expression Region: 21-147aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 29.6 kDa

Alternative Name(s): Prealbumin

Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.

Reference: Human-murine transthyretin heterotetramers are kinetically stable and non-amyloidogenic. A lesson in the generation of transgenic models of diseases involving oligomeric proteins.Reixach N., Foss T.R., Santelli E., Pascual J., Kelly J.W., Buxbaum J.N.J. Biol. Chem. 283:2098-2107(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details