Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse TM2 domain-containing protein 3(Tm2d3)

Recombinant Mouse TM2 domain-containing protein 3(Tm2d3)

SKU:CSB-CF804358MO

Regular price £1,282.00 GBP
Regular price Sale price £1,282.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8BJ83

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IKDPGPTRTFSVVPRAAENQLFSHLTESTEIPPYMTKCPSNGLCSRLPADCIECATNVSC TYGKPVTFDCTVKPSVTCVDQDLKPQRNFVINMTCRFCWQLPETDYECSNSTTCMTVACP RQRYFANCTVRDHIHCLGNRTFPKLLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWR EGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI

Protein Names:Recommended name: TM2 domain-containing protein 3

Gene Names:Name:Tm2d3

Expression Region:45-261

Sequence Info:full length protein

View full details