Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tenascin(Tnc),partial

Recombinant Mouse Tenascin(Tnc),partial

SKU:CSB-MP768917MO

Regular price £796.00 GBP
Regular price Sale price £796.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:Q80YX1

Gene Names:Tnc

Organism:Mus musculus (Mouse)

AA Sequence:GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Expression Region:1884-2099aa

Sequence Info:Partial

Source:Mammalian cell

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:28.8 kDa

Alternative Name(s):Hexabrachion Tenascin-C Short name: TN-C Hxb

Relevance:Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells

Reference:"Murine tenascin-W: a novel mammalian tenascin expressed in kidney and at sites of bone and smooth muscle development." Scherberich A., Tucker R.P., Samandari E., Brown-Luedi M., Martin D., Chiquet-Ehrismann R. J. Cell Sci. 117:571-581(2004)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8

Involvement in disease:

Subcellular Location:Secreted, extracellular space, extracellular matrix

Protein Families:Tenascin family

Tissue Specificity:Expressed in kidney, aortic valve, corneal limbus, periosteum around the ribs, cerebellum, stomach and intestine (PubMed:14709716). High levels of isoform 2 in lung and brain of newborn mice. High levels of isoform 5 in thymus, moderate levels in brain of newborn and adult mice. Low level of isoform 2 in adult brain.

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=454219

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:21923

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details