Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Taste receptor type 2 member 4(Tas2r4)

Recombinant Mouse Taste receptor type 2 member 4(Tas2r4)

SKU:CSB-CF864357MO

Regular price £1,350.00 GBP
Regular price Sale price £1,350.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9JKT3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLWELYVFVFAASVFLNFVGIIANLFIIVIIIKTWVNSRRIASPDRILFSLAITRFLTLG LFLLNSVYIATNTGRSVYFSTFFLLCWKFLDANSLWLVTILNSLYCVKITNFQHPVFLLL KRTISMKTTSLLLACLLISALTTLLYYMLSQISRFPEHIIGRNDTSFDLSDGILTLVASL VLNSLLQFMLNVTFASLLIHSLRRHIQKMQRNRTSFWNPQTEAHMGAMRLMICFLVLYIP YSIATLLYLPSYMRKNLRAQAICMIITAAYPPGHSVLLIITHHKLKAKAKKIFCFYK

Protein Names:Recommended name: Taste receptor type 2 member 4 Short name= T2R4 Alternative name(s): Taste receptor type 2 member 8 Short name= T2R8

Gene Names:Name:Tas2r4 Synonyms:Tas2r108, Tas2r8

Expression Region:1-297

Sequence Info:full length protein

View full details