Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Single Ig IL-1-related receptor(Sigirr),partial

Recombinant Mouse Single Ig IL-1-related receptor(Sigirr),partial

SKU:CSB-EP888356MO

Regular price £873.00 GBP
Regular price Sale price £873.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: Q9JLZ8

Gene Names: Sigirr

Organism: Mus musculus (Mouse)

AA Sequence: MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Expression Region: 1-117aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 28.7 kDa

Alternative Name(s): Single Ig IL-1R-related molecule Single immunoglobulin domain-containing IL1R-related protein Toll/interleukin-1 receptor 8 Short name: TIR8

Relevance: Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity).

Reference: "Intestinal inflammation in mice deficient in Tir8, an inhibitory member of the IL-1 receptor family."Garlanda C., Riva F., Polentarutti N., Buracchi C., Sironi M., De Bortoli M., Muzio M., Bergottini R., Scanziani E., Vecchi A., Hirsch E., Mantovani A.Proc. Natl. Acad. Sci. U.S.A. 101:3522-3526(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details