Gene Bio Systems
Recombinant Mouse Serine palmitoyltransferase small subunit A(Sptssa)
Recombinant Mouse Serine palmitoyltransferase small subunit A(Sptssa)
SKU:CSB-CF823162MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q8R207
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSVVGMALYTGYVFMPQHI MAILHYFEIVQ
Protein Names:Recommended name: Serine palmitoyltransferase small subunit A Alternative name(s): Small subunit of serine palmitoyltransferase A Short name= ssSPTa
Gene Names:Name:Sptssa Synonyms:Ssspta
Expression Region:1-71
Sequence Info:full length protein
