Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Receptor expression-enhancing protein 5(Reep5)

Recombinant Mouse Receptor expression-enhancing protein 5(Reep5)

SKU:CSB-CF723351MO

Regular price £1,253.00 GBP
Regular price Sale price £1,253.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q60870

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGF GYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWLPFYYMLKCGFLLWC MAPSPANGAEMLYRRIIRPIFLRHESQVDSVVKDVKDKAKETADAISKEVKKATVNLLGD VKKST

Protein Names:Recommended name: Receptor expression-enhancing protein 5 Alternative name(s): GP106 Polyposis locus protein 1 homolog Protein TB2 homolog

Gene Names:Name:Reep5 Synonyms:Dp1

Expression Region:1-185

Sequence Info:full length protein

View full details